Defizient
Wörterbuch
-
Defizientm · math.
Beispiele im Kontext
-
Coryneformes Bakterium, das eine L-Glutamin erzeugende Fähigkeit aufweist und modifiziert wurde, so dass die intrazelluläre Glutaminsynthetaseaktivität und die. Glutamatdehydrogenaseaktivität simultan erhöht sind, wobei die Glutamatdehydrogenaseaktivität durch Erhöhung der Kopiezahl eines Gens, codierend für Glutamatdehydrogenase, erhöht ist, und die Glutaminsynthetaseaktivität durch eine Defizienz in der Aktivitätskontrolle der intrazellulären Glutaminsynthetase durch Adenylylierung erhöht ist, wobei die Aktivitätskontrolle der intrazellulären Glutaminsynthetase durch Adenylylierung durch ein oder mehrere der folgenden defizient ist, nämlich dass eine Glutaminsynthetase beherbergt wird, deren Aktivitätskontrolle durch Adenylylierung beeinträchtigt ist, Abnahme der Glutaminsynthetaseadenylyltransferaseaktivitäten in der bakteriellen Zelle und Abnahme der PII-Proteinaktivität in der bakteriellen Zelle, so dass die Produktionsrate von L-Glutamin im Medium verbessert wird.
A coryneform bacterium which has L-glutamine producing ability and has been modified so that its intracellular glutamine synthetase activity and glutamate dehydrogenase activity are simultaneously enhanced, wherein the glutamate dehydrogenase activity is enhanced by increasing copy number of a gene coding for glutamate dehydrogenase, and the glutamine synthetase activity is enhanced by deficiency in activity control of intracellular glutamine synthetase by adenylylation, wherein the activity control of intracellular glutamine synthetase by adenylylation is defected by one or more of harboring glutamine synthetase of which activity control by adenylylation is defected, decrease of glutamine synthetase, adenylyl transferase activity in the bacterial cell and decrease of PII protein activity in the bacterial cell, so that production rate of L-glutamine is in the medium improved.