codierend

Verfahren nach Anspruch 28, wobei das zu exprimierende Nucleinsäurefragment aus der Gruppe, bestehend aus Genen, codierend: Enzyme, beteiligt an der Produktion von Isoprenoidmolekülen, Polyhydroxyalkansäure-(PHA)-Synthasen, Carotinoidbiosynthese-Enzymen, Nitrilhydratasen, Ethylen erzeugendem Enzym, Pyruvatdecarboxylase, Alkoholdehydrogenase, Terpensynthasen und Cholesteroloxidase, ausgewählt ist.

A method according to Claim 28 wherein the nucleic acid fragment to be expressed is selected from the group consisting of genes encoding; enzymes involved in the production of isoprenoid molecules, polyhydroxyalkanoic acid (PHA) synthases, carotenoid biosynthesis enzymes, nitrile hydratases, ethylene forming enzyme, pyruvate decarboxylase, alcohol dehydrogenase, terpene synthases, and cholesterol oxidase.

Coryneformes Bakterium, das eine L-Glutamin erzeugende Fähigkeit aufweist und modifiziert wurde, so dass die intrazelluläre Glutaminsynthetaseaktivität und die. Glutamatdehydrogenaseaktivität simultan erhöht sind, wobei die Glutamatdehydrogenaseaktivität durch Erhöhung der Kopiezahl eines Gens, codierend für Glutamatdehydrogenase, erhöht ist, und die Glutaminsynthetaseaktivität durch eine Defizienz in der Aktivitätskontrolle der intrazellulären Glutaminsynthetase durch Adenylylierung erhöht ist, wobei die Aktivitätskontrolle der intrazellulären Glutaminsynthetase durch Adenylylierung durch ein oder mehrere der folgenden defizient ist, nämlich dass eine Glutaminsynthetase beherbergt wird, deren Aktivitätskontrolle durch Adenylylierung beeinträchtigt ist, Abnahme der Glutaminsynthetaseadenylyltransferaseaktivitäten in der bakteriellen Zelle und Abnahme der PII-Proteinaktivität in der bakteriellen Zelle, so dass die Produktionsrate von L-Glutamin im Medium verbessert wird.

A coryneform bacterium which has L-glutamine producing ability and has been modified so that its intracellular glutamine synthetase activity and glutamate dehydrogenase activity are simultaneously enhanced, wherein the glutamate dehydrogenase activity is enhanced by increasing copy number of a gene coding for glutamate dehydrogenase, and the glutamine synthetase activity is enhanced by deficiency in activity control of intracellular glutamine synthetase by adenylylation, wherein the activity control of intracellular glutamine synthetase by adenylylation is defected by one or more of harboring glutamine synthetase of which activity control by adenylylation is defected, decrease of glutamine synthetase, adenylyl transferase activity in the bacterial cell and decrease of PII protein activity in the bacterial cell, so that production rate of L-glutamine is in the medium improved.

Verwendung eines Gens, codierend eine Cholinoxidase, die von den Erdbakterien Arthrobacter globiformis oder Arthrobacter pascens abstammt, zur Erzeugung einer temperaturtoleranten höheren Pflanze, wobei die Temperaturtoleranz eine Fähigkeit der transformierten Pflanze zum Wachstum bei höheren oder niedrigeren Temperaturen als den Temperaturen bedeutet, die normalerweise nicht-transformierten Pflanzen das Wachstum erlauben, durch Transformation der Pflanze mit dem Gen, wobei die höhere Pflanze eine Dicotyledone oder eine Monocotyledone ist.

Use of a gene encoding choline oxidase derived from the soil bacteria Arthrobacter globiformis or Arthrobacter pascens for producing a temperature-tolerant higher plant wherein temperature-tolerance means an ability of the transformed plant to grow at higher or lower temperatures than the temperatures that normally allow non-transformed plants to grow, by transformation of said plant with said gene, wherein the higher plant is a dicotyledon or a monocotyledon.

Bakterienstamm nach einem der Ansprüche 1 bis 9 mit Genen, codierend Exopolysaccharid synthetisierende Enzyme, wobei die Enzyme aus der Gruppe, bestehend aus SEQ ID NO: 22, 24, 26, 28, 30, 32, 34, 36 und 38, ausgewählt sind.

The bacterial strain of any of Claims 1 to 9 having genes encoding exopolysaccharide synthesizing enzymes, the enzymes selected from the group consisting of SEQ ID NO: 22, 24, 26, 28, 30, 32, 34, 36 and 38.

DNA-Sequenz, codierend für ein Protein gemäß Anspruch 1 oder 2, die sich nicht in einer Pentadiplandra brazzeana Baillon-Zelle befindet.

A DNA sequence coding for a protein as defined in claim 1 or 2 that is not in a Pentadiplandra brazzeana Baillon cell.

Antisense-Oligonukleotid zur Verwendung als Medikament zum Bekämpfen von aberrantem Spleißen in einem prä-mRNA-Molekül, enthaltend eine Mutation, wobei das prä-mRNA-Molekül eine erste Gruppe von Spleißelementen, definierend ein natives Intron, enthält, welches durch Spleißen entfernt wird, wenn die Mutation abwesend ist, um ein erstes mRNA-Molekül, codierend ein natives Protein, zu erzeugen; und wobei die prä-mRNA weiterhin eine zweite Gruppe von Spleißelementen, induziert durch die Mutation und definierend ein aberrantes Intron, verschieden von dem nativen Intron, enthält, welches aberrante Intron durch Spleißen entfernt wird, wenn die Mutation vorhanden ist, um ein aberrantes zweites mRNA-Molekül, verschieden von dem ersten mRNA-Molekül, zu erzeugen; wobei das Medikament umfaßt: ein antisense-Oligonukleotid, fähig zum Hybridisieren mit dem prä-mRNA-Molekül, um unter Bedingungen, welche Spleißen gestatten, ein doppelsträngiges Molekül hervorzubringen, wobei das antisense-Oligonukleotid RNase H nicht aktiviert; und wobei das Oligonukleotid ein Glied der aberranten zweiten Gruppe von Spleißelementen blockiert; so daß das native Intron durch Spleißen entfernt wird und das erste mRNA-Molekül, codierend ein Protein, erzeugt wird, und wobei der Hybridisierungsschritt in einer Zelle ausgeführt wird und wobei die erste mRNA in das native Protein translatiert wird.

An antisense oligonucleotide for use as a medicament for combating aberrant splicing in a pre-mRNA molecule containing a mutation, wherein said pre-mRNA molecule contains a first set of splice elements defining a native intron which is removed by splicing when said mutation is absent to produce a first mRNA molecule encoding a native protein; and wherein said pre-mRNA further contains a second set of splice elements induced by said mutation and defining an aberrant intron different from said native intron, which aberrant intron is removed by splicing when said mutation is present to produce an aberrant second mRNA molecule different from said first mRNA molecule; said medicament comprising: an antisense oligonucleotide capable of hybridising to said pre-mRNA molecule to create a duplex molecule under conditions which permit splicing, wherein said antisense oligonucleotide does not activate RNase H; and wherein said oligonucleotide blocks a member of said aberrant second set of splice elements; so that said native intron is removed by splicing and said first mRNA molecule encoding a protein is produced, and wherein said hybridising step is carried out in a cell, and wherein said first mRNA is translated into said native protein.